IL3RA Rabbit Polyclonal Antibody

• Catalog Number: orb585755
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL3RA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: IL3RA
• UniProt ID: P26951
• Protein Sequence: Synthetic peptide located within the following region: IQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRF
• NCBI: NP_002174
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 5 ug/ml.

WB Suggested Anti-IL3RA Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.