You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581287 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IL33 |
Target | IL33 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IL33 |
Protein Sequence | Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC |
UniProt ID | O95760 |
MW | 31kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DVS27, IL1F11, NF-HEV, NFEHEV, C9orf26 |
Note | For research use only |
NCBI | NP_254274 |
Positive control (+): Human Brain (BR), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 2 ug/ml.
Skin
WB Suggested Anti-IL33 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.
IF, IHC-Fr, IHC-P | |
Rat | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |