IL32 Rabbit Polyclonal Antibody

• Catalog Number: orb584780
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL32
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human IL32
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27 kDa
• Target: IL32
• UniProt ID: P24001
• Protein Sequence: Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd, IL-32beta,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml.