IL22 Rabbit Polyclonal Antibody

• Catalog Number: orb580768
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL22
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IL22
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20 kDa
• Target: IL22
• UniProt ID: Q9GZX6
• Protein Sequence: Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
• NCBI: NP_065386
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TIFa, IL-21, IL-22, ILTIF, IL-TIF, IL-D110, zcyto1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

WB Suggested Anti-IL22 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.