You have no items in your shopping cart.
Cart summary
Item 1 of 1
IL17RD Rabbit Polyclonal Antibody
Catalog Number: orb585147
| Catalog Number | orb585147 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to IL17RD |
| Target | IL17RD |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL17RD |
| Protein Sequence | Synthetic peptide located within the following region: STKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYV |
| UniProt ID | Q8NFM7 |
| MW | 65kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SEF, HH18, IL-17RD, IL17RLM |
| Note | For research use only |
Sample Type: THP-1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 1
Anti-IL-17RD Antibody [orb411645]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
