Cart summary

You have no items in your shopping cart.

IL17A Rabbit Polyclonal Antibody (Biotin)

IL17A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2099158

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2099158
CategoryAntibodies
DescriptionIL17A Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Goat, Human, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IL17A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW15kDa
UniProt IDQ16552
Protein SequenceSynthetic peptide located within the following region: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN
NCBINP_002181
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesIL17, CTLA8, IL-17, CTLA-8, IL-17A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.