Il15ra Rabbit Polyclonal Antibody

• Catalog Number: orb585666
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL15RA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: Il15ra
• UniProt ID: Q60819
• Protein Sequence: Synthetic peptide located within the following region: NYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDP
• NCBI: NP_032384
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IL-15RA, AA690181
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Il15ra Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.