IKZF4 Rabbit Polyclonal Antibody

• Catalog Number: orb330063
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IKZF4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Mouse, Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human IKZF4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: IKZF4
• UniProt ID: Q9H2S9
• Protein Sequence: Synthetic peptide located within the following region: GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE
• NCBI: NP_071910
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EOS antibody, anti KIAA1782 antibody, anti ZN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-IKZF4 Antibody, Catalog Number: orb330063, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-IKZF4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, IKZF4 is supported by BioGPS gene expression data to be expressed in 721_B.