IKBKB Rabbit Polyclonal Antibody

SKU: orb329679

Description

Rabbit polyclonal antibody to IKBKB

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKB
• Target: IKBKB
• Protein Sequence: Synthetic peptide located within the following region: CITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNN
• Molecular Weight: 86kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ40509 antibody, anti IKK-beta antibody, anti IKK2 antibody, anti IKKB antibody, anti MGC131801 antibody, anti NFKBIKB antibody

Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, IKBKB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Application: Western blotting Species+tissue/cell type: Lane 1: 100 ug mouse liver lysate, Lane 2: 100 ug mouse brain lysate, Lane 3: 100 ug mouse heart lysate, Lane 4: 100 ug mouse kidney lysate, Lane 5: 100 ug mouse lung lysate, Lane 6: 100 ug mouse thymus lysate, Lane 7: 100 ug mouse spleen lysate, Lane 8: 100 ug mouse testis lysate, Lane 9: 100 ug HeLa cell lysate, Primary antibody Dilution: 1:1000, Secondary antibody:Anti-rabbit-AP, Secondary antibody Dilution: 1:10000.

Sample Type: Primary vascular endothelial cells. Protocol: Loaded 30 ug of cell lysate of each. One normal, one cultured with high glucose (which enhances IKK Beta). Expected band is cut. 10% Gel concentration.Primary Dilution: 1:1000.

WB Suggested Anti-IKBKB Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.

Quick Database Links

Gene Symbol

IKBKB

UniProt

O14920

RefSeq (Protein):NP_001547