IHH Rabbit Polyclonal Antibody

• Catalog Number: orb579416
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IHH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IHH
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45 kDa
• Target: IHH
• UniProt ID: Q14623
• Protein Sequence: Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
• NCBI: NP_002172
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BDA1, HHG2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-IHH Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.