You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579416 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to IHH |
| Target | IHH |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IHH |
| Protein Sequence | Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR |
| UniProt ID | Q14623 |
| MW | 45 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | BDA1, HHG2 |
| Research Area | Cell Biology, Epigenetics & Chromatin, Molecular B Read more... |
| Note | For research use only |
| NCBI | NP_002172 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-IHH Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P | |
Canine, Equine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Canine, Equine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review