Ighmbp2 Rabbit Polyclonal Antibody

SKU: orb324754

Description

Rabbit polyclonal antibody to Ighmbp2

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Ighmbp2
• Protein Sequence: Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL
• Molecular Weight: 109 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AEP antibody, anti Catf1 antibody, anti RIPE3b1 antibody, anti Smbp-2 antibody, anti Smbp2 antibody, anti Smubp2 antibody, anti nmd antibody, anti sma antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein isoforms of 117 kDa, 109 kDa, 95 kDa and 42 kDa contain the immunizing peptide.

WB Suggested Anti-Ighmbp2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Heart.

Quick Database Links

Gene Symbol

Ighmbp2

UniProt

P40694

RefSeq (Protein):NP_033238