IGFBP7 Rabbit Polyclonal Antibody

SKU: orb330531

Description

IGFBP7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IGFBP7. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7
• Target: IGFBP7
• Protein Sequence: Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
• Molecular Weight: 29 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FSTL2 antibody, anti IGFBP-7 antibody, anti IGFBP-7v antibody, anti MAC25 antibody, anti PSF antibody, anti AGM antibody, anti TAF antibody, anti IBP-7 antibody, anti RAMSVPS antibody, anti IGFBPRP1 antibody

Quick Database Links

Gene Symbol

IGFBP7

UniProt

Q16270

RefSeq (Protein):NP_001544