You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330531 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to IGFBP7 |
| Target | IGFBP7 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7 |
| Protein Sequence | Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH |
| UniProt ID | Q16270 |
| MW | 29 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FSTL2 antibody, anti IGFBP-7 antibody, anti I Read more... |
| Research Area | Cell Biology, Signal Transduction |
| Note | For research use only |
| NCBI | NP_001544 |

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be slightly modified by both glycosylation and phosphorylation.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

IGFBP7 antibody - C-terminal region (orb330531), Catalog Number: orb330531, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of pneumocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-IGFBP7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
ELISA, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review