IFT140 Rabbit Polyclonal Antibody

• Catalog Number: orb324653
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IFT140
• Target: IFT140
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFT140
• Protein Sequence: Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
• UniProt ID: Q96RY7
• MW: 165kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DKFZp564L232 antibody, anti FLJ10306 antibody
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_055529

Sample Type: 1. Human RPE cell line (15 ug), 2. Bovine retina lysate cleared at 100000 Xg for 2 hours (15 ug), Primary Dilution: 1:1000, Secondary Anditbody: goat anti-rabbit HRP, Scondary Dilution: 1:10000.

WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.