IFT140 Rabbit Polyclonal Antibody

SKU: orb324653

Description

Rabbit polyclonal antibody to IFT140

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFT140
• Target: IFT140
• Protein Sequence: Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
• Molecular Weight: 165kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp564L232 antibody, anti FLJ10306 antibody, anti FLJ30571 antibody, anti KIAA0590 antibody, anti WDTC2 antibody, anti c305C8.4 antibody, anti c380F5.1 antibody, anti gs114 antibody

Sample Type: 1. Human RPE cell line (15 ug), 2. Bovine retina lysate cleared at 100000 Xg for 2 hours (15 ug), Primary Dilution: 1:1000, Secondary Anditbody: goat anti-rabbit HRP, Scondary Dilution: 1:10000.

WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.

Quick Database Links

Gene Symbol

IFT140

UniProt

Q96RY7

RefSeq (Protein):NP_055529