Cart summary

You have no items in your shopping cart.

IFNA13 Rabbit Polyclonal Antibody (Biotin)

IFNA13 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2096977

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2096977
CategoryAntibodies
DescriptionIFNA13 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Goat, Human, Porcine, Sheep
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human IFNA13
Protein SequenceSynthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
UniProt IDP01562
MW21kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesIFNA1
NoteFor research use only
NCBINP_008831