IFITM1 Rabbit Polyclonal Antibody

• Catalog Number: orb588971
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IFITM1
• Target: IFITM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFITM1
• Protein Sequence: Synthetic peptide located within the following region: HKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCC
• UniProt ID: P13164
• MW: 14 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 9-27, CD225, IFI17, LEU13, DSPA2a
• Research Area: Epigenetics, Immunology
• Note: For research use only
• NCBI: NP_003632.3
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.