IFIH1 Rabbit Polyclonal Antibody

• Catalog Number: orb575983
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IFIH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFIH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 117kDa
• Target: IFIH1
• UniProt ID: Q9BYX4
• Protein Sequence: Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
• NCBI: NP_071451
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.

Lanes: 1: 20 ug HEK293T no transfection, 2: 20 ug HEK293T 3Flag-MDA5/IFIH1, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:1000, Gene Name: IFIH1, IFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.