IFIH1 Rabbit Polyclonal Antibody

SKU: orb575983

Description

Rabbit polyclonal antibody to IFIH1

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Signal Transduction

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Equine, Mouse, Porcine, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human IFIH1
Target	IFIH1
Protein Sequence	Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
Molecular Weight	117kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.

Lanes: 1: 20 ug HEK293T no transfection, 2: 20 ug HEK293T 3Flag-MDA5/IFIH1, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:1000, Gene Name: IFIH1, IFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

IFIH1

UniProt

Q9BYX4

RefSeq (Protein):NP_071451

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_071451

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols