Cart summary

You have no items in your shopping cart.

IFI44L Rabbit Polyclonal Antibody (FITC)

IFI44L Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2117115

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2117115
CategoryAntibodies
DescriptionIFI44L Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L
Protein SequenceSynthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
UniProt IDQ99984
MW47kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesGS3686, C1orf29
NoteFor research use only
NCBINP_006811