You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
IFI44L Rabbit Polyclonal Antibody
Catalog Number: orb579706
| Catalog Number | orb579706 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to IFI44L |
| Target | IFI44L |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L |
| Protein Sequence | Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT |
| UniProt ID | Q99984 |
| MW | 47kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GS3686, C1orf29 |
| Note | For research use only |
| NCBI | NP_006811 |
Human kidney
WB Suggested Anti-IFI44L Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
- Item 1 of 2
IFI44L Rabbit Polyclonal Antibody [orb157629]
WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
