IDH3A Rabbit Polyclonal Antibody

• Catalog Number: orb578394
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IDH3A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IDH3A
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: IDH3A
• UniProt ID: P50213
• Protein Sequence: Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK
• NCBI: NP_005521
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RP90
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): 293T (2T), Negative control (-): Liver tumor (T-LI), Antibody concentration: 1 ug/ml.

IDH3A was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb578394 with 1:200 dilution. Western blot was performed using orb578394 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: IDH3A IP with orb578394 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Rabbit Anti-IDH3A Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-IDH3A Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. IDH3A is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.