ID4 Rabbit Polyclonal Antibody

SKU: orb574139

Description

Rabbit polyclonal antibody to ID4

Research Area

Epigenetics & Chromatin, Molecular Biology, Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ID4
• Target: ID4
• Protein Sequence: Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
• Molecular Weight: 16kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

IDB4, bHLHb27

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.

Lane 1: 10 ug MDA-MB231 lysate, Lane 2: 10 ug MCF7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: ID4.

WB Suggested Anti-ID4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ID4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Quick Database Links

Gene Symbol

ID4

UniProt

P47928

RefSeq (Protein):NP_001537