You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574139 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ID4 |
Target | ID4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ID4 |
Protein Sequence | Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP |
UniProt ID | P47928 |
MW | 16kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | IDB4, bHLHb27 |
Note | For research use only |
NCBI | NP_001537 |
Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.
Lane 1: 10 ug MDA-MB231 lysate, Lane 2: 10 ug MCF7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: ID4.
WB Suggested Anti-ID4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ID4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
WB | |
Canine, Mouse, Porcine, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC, IHC-P, WB | |
Porcine | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |