ID4 Rabbit Polyclonal Antibody

• Catalog Number: orb574139
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ID4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ID4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: ID4
• UniProt ID: P47928
• Protein Sequence: Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
• NCBI: NP_001537
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IDB4, bHLHb27
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.

Lane 1: 10 ug MDA-MB231 lysate, Lane 2: 10 ug MCF7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: ID4.

WB Suggested Anti-ID4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ID4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.