Cart summary

You have no items in your shopping cart.

    IAPP Antibody - N-terminal region : FITC

    IAPP Antibody - N-terminal region : FITC

    Catalog Number: orb2123307

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2123307
    CategoryAntibodies
    DescriptionIAPP Antibody - N-terminal region : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IAPP
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW4kDa
    UniProt IDP10997
    Protein SequenceSynthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV
    NCBINP_000406
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesDAP, IAP
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars