HYAL1 antibody

• Catalog Number: orb330624
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HYAL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HYAL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: HYAL1
• UniProt ID: Q12794
• Protein Sequence: Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY
• NCBI: NP_695014
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HYAL-1 antibody, anti LUCA1 antibody, anti MG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HepG2 tissue using HYAL1 antibody

Immunohistochemical staining of human Breast tissue using HYAL1 antibody

Immunohistochemical staining of human Liver tissue using HYAL1 antibody

Western blot analysis of human Fetal Lung tissue using HYAL1 antibody

Western blot analysis of human Fetal Brain tissue using HYAL1 antibody