Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human VEGI protein
Catalog Number orb429203
ReactivityHuman
ConjugationUnconjugated
Target VEGI
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
The TNFSF15 was lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.
Purity >95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source Escherichia Coli.
Activity The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0
Product Description

Recombinant of human VEGI protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Reviews
Write Your Own Review
You're reviewing:Human VEGI protein - orb429203
Your Rating