You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb429203 |
---|---|
Category | Tools |
Description | Recombinant of human VEGI protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Source | Escherichia Coli |
Biological Activity | The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0×104 IU/mg. |
Storage | Stability: TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGI should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
Buffer/Preservatives | The TNFSF15 was lyophilized from a 0.2µm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20. |
Alternative names | Tumor necrosis factor ligand superfamily member 15 Read more... |
Note | For research use only |
Application notes | Cytokines And Growth Factors |
Expiration Date | 12 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 46.6 kDa after removal of the signal peptide. The apparent molecular mass of hFc-cTNFSF15 is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 47.6 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mTNFSF15 is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 46.6 kDa after removal of the signal peptide. The apparent molecular mass of hFc-TNFSF15 is approximately 35-55kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
90% | |
22.3 kDa | |
Cynomolgus/Rhesus macaque TL1A / TNFSF15, His Tag (orb1496224) is expressed from human 293 cells (HEK293). It contains AA Leu 72 - Leu 251 (Accession # F6S8F9-1). |
Biotin | |
90% | |
24.1 kDa | |
Biotinylated Human TL1A Protein, His, (orb1496271) is expressed from human 293 cells (HEK293). It contains AA Leu 72- Leu 251 (Accession # O95150-1). |
Filter by Rating