You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human VEGFA protein
Catalog Number: orb419318
| Catalog Number | orb419318 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Vascular endothelial growth factor A active |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| MW | 19.3 kDa |
| UniProt ID | P15692 |
| Protein Sequence | M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Protein Length | Partial of Isoform 4 |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. |
| Expression Region | 27-191aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
| Alternative names | VEGF-A, VPF Read more... |
| Note | For research use only |
| Application notes | Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 4
Human VEGF165 Protein [orb257923]
Unconjugated
95%
19.2 kDa
Human VEGF165, premium grade (orb257923) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 191 (Accession # P15692-4).
1 mg, 50 μg, 20 μg - Item 1 of 3
Human VEGF121 Protein [orb257918]
Unconjugated
95%
14.1 kDa
Human VEGF121 Protein, premium grade (orb257918) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 147 (Accession # P15692-9).
1 mg, 50 μg, 20 μg - Item 1 of 3
Human VEGF165 Protein, His Tag [orb257924]
Unconjugated
90%
21.1 kDa
Human VEGF165, His Tag (orb257924) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 191 (Accession # P15692-4).
1 mg, 50 μg - Item 1 of 3
Mouse VEGF120 Protein [orb257917]
Unconjugated
95%
14.1 kDa
Mouse VEGF120 Protein, Tag Free (orb257917) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 146 (Accession # AAB22254.1 ).
1 mg, 50 μg, 20 μg - Item 1 of 3
Mouse VEGF164 Protein [orb257922]
Unconjugated
95%
19.3 kDa
Mouse VEGF164 Protein, Tag Free (orb257922) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 190 (Accession # AAB22253.1 ).
20 μg, 1 mg, 50 μg
