Human VEGFA protein

• Catalog Number: orb419318
• Category: Proteins
• Description: Recombinant Human Vascular endothelial growth factor A active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Protein Sequence: M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Protein Length: Partial of Isoform 4
• UniProt ID: P15692
• MW: 19.3 kDa
• Application notes: Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml.
• Expression Region: 27-191aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: VEGF-A, VPF
• Research Area: Cancer Biology
• Note: For research use only