Human VEGFA protein

SKU: orb419318

Description

This Human VEGFA protein spans the amino acid sequence from region 27-191aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length

Key Properties

• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml.
• Tag: Tag-Free
• Molecular Weight: 19.3 kDa
• Expression Region: 27-191aa
• Protein Length: Partial of Isoform 4
• Protein Sequence: M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

VEGF-A, VPF

Quick Database Links

UniProt

P15692