Cart summary

You have no items in your shopping cart.

Human VEGFA protein

Catalog Number: orb419318

Select Product Size
SizePriceQuantity
10 μg$ 400.00
100 μg$ 1,460.00
500 μg$ 3,170.00
10 μg Enquire
100 μg Enquire
500 μg Enquire
DispatchUsually dispatched within 1-2 weeks
Catalog Numberorb419318
CategoryProteins
DescriptionRecombinant Human Vascular endothelial growth factor A active
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
Purity> 97% as determined by SDS-PAGE and HPLC.
Protein SequenceM+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Protein LengthPartial of Isoform 4
UniProt IDP15692
MW19.3 kDa
Application notesTag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceYeast
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml.
Expression Region27-191aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesVEGF-A, VPF
Research AreaCancer Biology
NoteFor research use only
Expiration Date6 months from date of receipt.
Human VEGFA protein

  • Human VEGFA Protein, His Tag [orb757432]

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide.

    Mammalian

    50 μg, 10 μg, 100 μg
  • Human VEGF 165 protein [orb178366]

    SDS-PAGE

    Unconjugated

    > 85% as determined by SDS-PAGE

    0.5 mg, 1 mg, 0.1 mg
  • Human VEGFA Protein, hFc Tag [orb1290979]

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 40.1 kDa after removal of the signal peptide. The apparent molecular mass of VEGFA-hFc is approximately 35-55 kDa due to glycosylation.

    Mammalian

    10 μg, 50 μg, 100 μg
  • Recombinant human VEGF-165 protein, His (HEK293) [orb1516684]

    >95% as determined by SDS-PAGE

    24 kDa

    100 μg, 500 μg, 20 μg
  • Human VEGF165 Protein, hFc Tag [orb2321384]

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 45.3 kDa after removal of the signal peptide. The apparent molecular mass of VEGF165-hFc is approximately 35-55 kDa due to glycosylation.

    Mammalian

    10 μg, 50 μg, 100 μg