You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419318 |
---|---|
Category | Proteins |
Description | Recombinant Human Vascular endothelial growth factor A active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
Protein Sequence | M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Protein Length | Partial of Isoform 4 |
UniProt ID | P15692 |
MW | 19.3 kDa |
Application notes | Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. |
Expression Region | 27-191aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | VEGF-A, VPF |
Research Area | Cancer Biology |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide. | |
Mammalian |
SDS-PAGE | |
Unconjugated | |
> 85% as determined by SDS-PAGE |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 40.1 kDa after removal of the signal peptide. The apparent molecular mass of VEGFA-hFc is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
>95% as determined by SDS-PAGE | |
24 kDa |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 45.3 kDa after removal of the signal peptide. The apparent molecular mass of VEGF165-hFc is approximately 35-55 kDa due to glycosylation. | |
Mammalian |