You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54568 |
---|---|
Category | Proteins |
Description | Recombinant human UBE2F protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR |
Protein Length | Full Length |
UniProt ID | Q969M7 |
MW | 48.1 kDa |
Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-181AA: 1-185AAFull Length of Isoform 3: Full Length |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1-185aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | NEDD8 carrier protein UBE2F NEDD8 protein ligase U Read more... |
Research Area | Epigenetics |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
20.2 kDa | |
E.Coli |