Human TR11B protein (Active)

• Catalog Number: orb359217
• Category: Proteins
• Description: Recombinant human TR11B active protein
• Tag: C-terminal Fc-tagged
• Form/Appearance: Lyophilized powder
• Purity: > 95% as determined by SDS-PAGE and HPLC.
• MW: 109.6 kDa
• UniProt ID: O00300
• Protein Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL+EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Protein Length: Partial
• Source: Yeast
• Expression System: Expression Region: 22-201aa. Protein Length: Partial
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by neutralizing the stimulation of U937 cells is less than 10 ng/ml, corresponding to a specific activity of ＞ 1.0 × 105 IU/mg in the presence of 10 ng/mL soluble rHuRANKL (sRANKL).
• Expression Region: 22-201aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 6.0, 150 mM NaCl, 0.02 % Tween-80
• Alternative names: Osteoclastogenesis inhibitory factor,
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.