Human TNFSF18 protein

• Catalog Number: orb705125
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor ligand superfamily member 18(TNFSF18),partial
• Tag: N-terminal hFc-Flag-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 94% as determined by SDS-PAGE.
• MW: 42.8 kDa
• UniProt ID: Q9UNG2
• Protein Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 , the EC50 is 2.565 to 2.940 ng/ml.; Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.
• Expression Region: 72-199aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml.

Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.