You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TMEM219 protein
Catalog Number: orb704873
| Catalog Number | orb704873 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Insulin-like growth factor-binding protein 3 receptor(TMEM219),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 22.7 kDa |
| UniProt ID | Q86XT9 |
| Protein Sequence | SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 39-204aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Transmembrane protein 219 Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human IGFBP-3 R Protein, Fc Tag [orb1496157]
Unconjugated
90%
44.3 kDa
Human IGFBP-3 R, Fc Tag (orb1496157) is expressed from human 293 cells (HEK293). It contains AA Ser 39 - Arg 204 (Accession # Q86XT9-1).
100 μg, 1 mg- Item 1 of 1
Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial [orb1785190]
Greater than 90% as determined by SDS-PAGE.
23.7 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
Human TMEM219 Protein, hFc Tag [orb1743289]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-TMEM219 is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
