You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604411 |
---|---|
Category | Proteins |
Description | Recombinant Human Thrombopoietin(THPO), partial |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 34.7 kDa |
UniProt ID | P40225 |
Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 22-195aa. Protein Length: Partial |
Expression Region | 22-195aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | C-mpl ligand Short name, ML Megakaryocyte colony-s Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
37.3 kDa | |
Mammalian cell |
Unconjugated | |
95% | |
35.6 kDa | |
Human Thrombopoietin, premium grade (orb867314) is expressed from human 293 cells (HEK293). It contains AA Ser 22 - Gly 353 (Accession # P40225-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
37.3 KDa | |
Mammalian |
> 97% by SDS-PAGE. | |
KMP1172, Recombinant Human Thrombopoietin/THPO Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ser22-Gly353) of human Thrombopoietin/THPO (Accession #NP_000451.1) fused with a 6×His Tag at the C-terminus. |
Filter by Rating