You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594751 |
---|---|
Category | Proteins |
Description | Recombinant Human Thrombopoietin(THPO) (Active) |
Tag | N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 37.3 kDa |
UniProt ID | P40225 |
Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | 22-353aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml. |
Expression Region | 22-353aa |
Endotoxins | Less than 0.01 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
Alternative names | Thrombopoietin;C-mpl ligand;Megakaryocyte colony-s Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Unconjugated | |
95% | |
35.6 kDa | |
Human Thrombopoietin, premium grade (orb867314) is expressed from human 293 cells (HEK293). It contains AA Ser 22 - Gly 353 (Accession # P40225-1). |
Greater than 85% as determined by SDS-PAGE. | |
34.7 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
37.3 KDa | |
Mammalian |
> 97% by SDS-PAGE. | |
KMP1172, Recombinant Human Thrombopoietin/THPO Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ser22-Gly353) of human Thrombopoietin/THPO (Accession #NP_000451.1) fused with a 6×His Tag at the C-terminus. |
Filter by Rating