Human TGFB3 protein

• Catalog Number: orb594759
• Category: Proteins
• Description: This Human TGFB3 protein spans the amino acid sequence from region 301-412aa(Y340F). Purity: Greater than 95% as determined by SDS-PAGE.
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
• Protein Length: Partial
• UniProt ID: P10600
• MW: 12.7 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml.
• Expression Region: 301-412aa(Y340F)
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Transforming growth factor beta-3;TGFB3;TGF-beta-3
• Research Area: Cancer Biology
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.