Human TGFB3 protein

Catalog Number: orb594759

Catalog Number	orb594759
Category	Proteins
Description	Recombinant Human Transforming growth factor beta-3(TGFB3),Partial (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	12.7 kDa
UniProt ID	P10600
Protein Sequence	ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Protein Length	Partial
Source	Mammalian cell
Expression System	Expression Region: 301-412aa(Y340F). Protein Length: Partial
Biological Activity	The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml.
Expression Region	301-412aa(Y340F)
Endotoxins	Less than 0.01 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5.
Alternative names	Transforming growth factor beta-3;TGFB3;TGF-beta-3 Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	42.1 kDa
Source:	Human TGFBR2, Fc Tag (orb257866) is expressed from human 293 cells (HEK293). It contains AA Thr 23 - Asp 159 (Accession # NP_003233).

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	16.7 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	48.1 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Conjugation:	Biotin
Purity:	90%
MW:	48.4 kDa
Source:	Biotinylated Human Latent TGFB3, His, (orb762452) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Ser 412 (Accession # P10600-1).