You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TGFB3 protein
Catalog Number: orb594759
| Catalog Number | orb594759 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Transforming growth factor beta-3(TGFB3),Partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 12.7 kDa |
| UniProt ID | P10600 |
| Protein Sequence | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml. |
| Expression Region | 301-412aa(Y340F) |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. |
| Alternative names | Transforming growth factor beta-3;TGFB3;TGF-beta-3 Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
Human TGFB3 protein [orb358393]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human TGFB3 protein [orb624033]
Greater than 90% as determined by SDS-PAGE.
16.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human TGFB3 Protein, hFc Tag [orb1291013]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 56 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg 
Human TGFB3 protein [orb392557]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μg
