You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594759 |
---|---|
Category | Proteins |
Description | Recombinant Human Transforming growth factor beta-3(TGFB3),Partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
Protein Length | Partial |
UniProt ID | P10600 |
MW | 12.7 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml. |
Expression Region | 301-412aa(Y340F) |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Transforming growth factor beta-3;TGFB3;TGF-beta-3 Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
48.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
16.7 kDa | |
E.coli |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 56 kDa after removal of the signal peptide. | |
Mammalian |
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 13-15 kDa based on Tris-Bis PAGE result. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |