You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244564 |
---|---|
Category | Proteins |
Description | Recombinant human Signal transducer and activator of transcription 3 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 38.3 kDa |
UniProt ID | P40763 |
Protein Sequence | ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 50-240aa. Protein Length: Partial |
Expression Region | 50-240aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | STAT3 Read more... |
Note | For research use only |
Application notes | Partial of His-SUMO-tag and expression region is 50-240aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
25.8 kDa | |
Human IFNAR2, His Tag (orb257560) is expressed from human 293 cells (HEK293). It contains AA Ile 27 - Lys 243 (Accession # P48551-2). |
Unconjugated | |
90% | |
37.7 kDa | |
Human IL-13 R alpha 1 Protein, His Tag (orb257580) is expressed from human 293 cells (HEK293). It contains AA Gly 22 - Thr 343 (Accession # NP_001551.1). |
Unconjugated | |
95% | |
51.4 kDa | |
Human IFNAR2, Fc Tag (orb257561) is expressed from human 293 cells (HEK293). It contains AA Ile 27 - Lys 243 (Accession # P48551-2). |
Unconjugated | |
95% | |
62.7 kDa | |
Mouse IL-13RA1, Fc Tag (orb257586) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Thr 340 (Accession # NP_598751). |
Unconjugated | |
95% | |
64.5 kDa | |
Human IL-23 R, Fc Tag (orb570284) is expressed from human 293 cells (HEK293). It contains AA Gly 24 - Gly 355 (Accession # Q5VWK5-1). |
Filter by Rating