You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246438 |
---|---|
Category | Proteins |
Description | Recombinant human Mothers against decapentaplegic homolog 3 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 64.1 kDa |
UniProt ID | P84022 |
Protein Sequence | MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS |
Protein Length | Full Length |
Source | E.coli |
Expression System | Expression Region: 1-425aa. Protein Length: Full Length |
Expression Region | 1-425aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | SMAD3 Read more... |
Note | For research use only |
Application notes | Full length of His-SUMO-tag and expression region is 1-425aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
20.3 kDa | |
Human IL-37b, His Tag (orb257616) is expressed from E. coli cells. It contains AA Val 46 - Asp 218 (Accession # AAH20637.1). |
Unconjugated | |
95% | |
20.1 kDa | |
Human IL-37, His Tag (orb1146980) is expressed from E. coli cells. It contains AA Lys 27 - Asp 192 (Accession # Q9NZH6-2). |
Unconjugated | |
95% | |
12.8 kDa | |
Human FKBP12, His Tag (orb257947) is expressed from E.coli cells. It contains AA Met 1 - Glu 108 (Accession # P62942-1). |
Greater than 85% as determined by SDS-PAGE. | |
50.6 kDa | |
Baculovirus |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Filter by Rating