You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb704564 |
---|---|
Category | Proteins |
Description | Recombinant Human SARS coronavirus Spike glycoprotein(S) ,partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 27 kDa |
UniProt ID | P59594 |
Protein Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
Protein Length | Partial |
Source | Yeast |
Expression System | Expression Region: 306-527aa. Protein Length: Partial |
Expression Region | 306-527aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Alternative names | E2 Peplomer protein Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
101.9 kDa | |
SARS-CoV-2 S1 protein, Mouse IgG2a Fc Tag (orb640170) is expressed from human 293 cells (HEK293). It contains AA Val 16 - Arg 685 (Accession # QHD43416.1). |
Crystallography, ELISA, IF | |
Virus | |
Recombinant | |
Unconjugated |
Greater than 95% as determined by SDS-PAGE. | |
30 kDa | |
Mammalian cell |
ELISA, IF | |
Virus | |
Human | |
Monoclonal | |
Unconjugated |
ELISA, IF | |
Virus | |
Human | |
Monoclonal | |
Unconjugated |
Filter by Rating