Human SARS coronavirus Spike glycoprotein(S) protein

• Catalog Number: orb668866
• Category: Proteins
• Description: Recombinant Human SARS coronavirus Spike glycoprotein(S) protein
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 30 kDa
• UniProt ID: P59594
• Protein Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
• Protein Length: Partial
• Source: Mammalian cell
• Expression System: Expression Region: 306-527aa. Protein Length: Partial
• Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 (CSB-MP684964PAL), the EC50 is 5.056-7.559 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 7.941-10.49 ng/ml.
• Expression Region: 306-527aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Alternative names: /
• Note: For research use only
• Application notes: SARS-CoV-2 Related Proteins
• Expiration Date: 6 months from date of receipt.