Human PLA2G2D protein

Catalog Number: orb244992

Catalog Number	orb244992
Category	Proteins
Description	Recombinant human Group IID secretory phospholipase A2
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Protein Length	Partial
UniProt ID	Q9UNK4
MW	30.5 kDa
Application notes	This is His-SUMO-tag protein
Endotoxins	Not test.
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	22-145aa
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative names	PLA2G2D
Note	For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Item 1 of 1
PLA2G2D (Human) Recombinant Protein (P01) [orb2285478]
Applications:
AP, Array, ELISA, WB
Sizes Available: 10 μg
Recombinant Human PLA2G2D Protein, N-His [orb2830759]
Purity:
> 90% as determined by SDS-PAGE.
MW:
16.85 kDa
Sizes Available: 100 μg, 50 μg, 20 μg

Purity:	> 85%, determined by SDS-PAGE
Source:	This protein contains the human PLA2G2D (Q9UNK4) (Met1-Cys145) was expressed with the Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.

Sizes Available: 100 μg, 20 μg

Purity:	Greater than 95.0% as determined by SDS-PAGE.
Source:	Escherichia Coli

Purity:	SDS-PAGE: ≥ 85%
MW:	41.5 kDa (predicted); 44 kDa (reducing conditions)