Human PDGF B protein

• Catalog Number: orb594736
• Category: Proteins
• Description: Recombinant Human Platelet-derived growth factor subunit B(PDGFB) (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution of 20mM NaAc-HAc, pH 4.5.
• Purity: Greater than 98% as determined by SDS-PAGE.
• Protein Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
• Protein Length: Full Length of Mature Protein
• UniProt ID: P01127
• MW: 12.42 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 5-20 ng/ml.
• Expression Region: 82-190aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Platelet-Derived Growth Factor Subunit B; PDGF Sub
• Research Area: Cancer Biology
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.