Human PDGF B protein

Catalog Number: orb594736

Catalog Number	orb594736
Category	Proteins
Description	Recombinant Human Platelet-derived growth factor subunit B(PDGFB) (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 98% as determined by SDS-PAGE.
MW	12.42 kDa
UniProt ID	P01127
Protein Sequence	SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 82-190aa. Protein Length: Full Length of Mature Protein
Biological Activity	The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 5-20 ng/ml.
Expression Region	82-190aa
Endotoxins	Less than 0.2 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered solution of 20mM NaAc-HAc, pH 4.5.
Alternative names	Platelet-Derived Growth Factor Subunit B; PDGF Sub Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	15.1 kDa
Source:	Unconjugated Human PDGF-BB, His, (orb334919) is expressed from E. coli cells. It contains AA Ser 82 - Thr 190 (Accession # P01127-1).

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	28.3 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	14.3 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli