You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604301 |
---|---|
Category | Proteins |
Description | Recombinant Human Platelet-derived growth factor subunit B(PDGFB) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Protein Length | Full Length of Mature Protein |
UniProt ID | P01127 |
MW | 28.3 kDa |
Application notes | Partial |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 82-190aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | PDGF-2 (Platelet-derived growth factor B chain) (P Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
14.3 kDa | |
E.coli |
Greater than 98% as determined by SDS-PAGE. | |
12.42 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
54.6 kDa | |
E.coli |
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result. |
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result. |