You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PDGF B protein
Catalog Number: orb604301
| Catalog Number | orb604301 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Platelet-derived growth factor subunit B(PDGFB) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P01127 |
| MW | 28.3 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 82-190aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | PDGF-2 (Platelet-derived growth factor B chain) (P Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human PDGF B protein [orb604302]
Greater than 90% as determined by SDS-PAGE.
14.3 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
Human PDGF B protein [orb594736]
Greater than 98% as determined by SDS-PAGE.
12.42 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human PDGFRB Protein [orb1477114]
Greater than 85% as determined by SDS-PAGE.
54.6 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293) [orb1516344]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293), Biotin conjugated [orb2328734]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result.
20 μg
