You have no items in your shopping cart.
Cart summary
Human NGF protein
Catalog Number: orb594749
| Catalog Number | orb594749 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Beta-nerve growth factor(NGF),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 13.5 kDa |
| UniProt ID | P01138 |
| Protein Sequence | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 122-239aa. Protein Length: Partial |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 2 ng/ml. |
| Expression Region | 122-239aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.0 |
| Alternative names | Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human BDNF / Abrineurin Protein, premium grade [orb1675341]
Unconjugated
95%
13.5 kDa
Human BDNF, premium grade (orb1675341) is expressed from human 293 cells (HEK293). It contains AA His 129 - Arg 247 (Accession # P23560-1).
1 mg, 50 μg, 20 μg - Item 1 of 1
Human HVEM / TNFRSF14 Protein [orb348800]
Unconjugated
90%
19.2 kDa
Human HVEM, His Tag (orb348800) is expressed from human 293 cells (HEK293). It contains AA Leu 39 - Val 202 (Accession # Q92956-1).
1 mg, 100 μg - Item 1 of 1
Human HVEM / TNFRSF14 Protein [orb257551]
Unconjugated
95%
43.5 kDa
Human HVEM, Fc Tag (orb257551) is expressed from human 293 cells (HEK293). It contains AA Leu 39 - Val 202 (Accession # NP_003811.2).
1 mg, 100 μg Human NGF protein [orb392183]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgHuman NGF protein [orb392184]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars