Human MOG Protein

• Catalog Number: orb81220
• Category: Proteins
• Description: Recombinant of Human MOG protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Protein Sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
• Application notes: Recombinant & Natural Proteins
• Source: Escherichia Coli
• Solubility (25°C): It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Storage: Stability: Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Alternative names: Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2,
• Note: For research use only