You have no items in your shopping cart.
Human MOG Protein
SKU: orb81220
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
Similar Products
−- Item 1 of 1
Human Anti-Myelin Oligodendrocyte Glycoprotein Antibody (Anti-MOG) ELISA Kit [orb781920]
Human
3.13-200 ng/mL
1.15 ng/mL
48 T, 96 T - Item 1 of 2
- Item 1 of 1
Human MOG protein [orb604902]
Greater than 85% as determined by SDS-PAGE.
17.9 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant human MOG protein, N-Trx-His [orb1516705]
>90% as determined by SDS-PAGE
35 kDa
500 μg, 100 μg, 20 μg - Item 1 of 1
Human MOG Protein, hFc Tag [orb2321424]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.4 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human MOG Protein (orb81220)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days