Human MOG Protein

SKU: orb81220

Description

Recombinant of Human MOG protein

Images & Validation

• Application Notes:
  Recombinant & Natural Proteins

Key Properties

• Source: Escherichia Coli
• Protein Sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
• Purity: Greater than 95.0% as determined by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5
• Disclaimer: For research use only

Alternative Names

Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.