You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human MOG protein
Catalog Number: orb604902
| Catalog Number | orb604902 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial |
| Tag | N-terminal 10xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG |
| Protein Length | Partial |
| UniProt ID | Q16653 |
| MW | 17.9 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 30-154aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | BTN6, BTNL11, MGC26137, MOG alpha 5, MOG alpha 6, Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
Human MOG Protein, hFc Tag [orb2321424]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.4 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human Anti-Myelin Oligodendrocyte Glycoprotein Antibody (Anti-MOG) ELISA Kit [orb781920]
Human
3.13-200 ng/mL
1.15 ng/mL
48 T, 96 T - Item 1 of 1
Recombinant human MOG protein, N-Trx-His [orb1516705]
> 90% as determined by SDS-PAGE
35 kDa
500 μg, 100 μg 
Human MOG protein [orb392152]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μg
