You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604902 |
---|---|
Category | Proteins |
Description | Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG |
Protein Length | Partial |
UniProt ID | Q16653 |
MW | 17.9 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 30-154aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | BTN6, BTNL11, MGC26137, MOG alpha 5, MOG alpha 6, Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 40.4 kDa after removal of the signal peptide. | |
Mammalian |
Human | |
3.13-200 ng/mL | |
1.15 ng/mL |
> 90% as determined by SDS-PAGE | |
35 kDa |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |