Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 5-10 working days
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00
Product Overview
| Product Name | Human MIP 5 protein |
|---|---|
| Catalog Number | orb427131 |
| Reactivity | Human |
| Conjugation | Unconjugated |
| Target | MIP 5 |
Product Properties
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl. |
|---|---|
| Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Note | For research use only. |
| Protein Sequence | QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI. |
| Purity | >97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Source | Escherichia Coli. |
| Activity | Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. |
Product Description
Recombinant of human MIP 5 protein
Solubility (25°C)
| Solubility (25°C) | It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
|---|
Reviews
Write Your Own Review
