Cart summary

You have no items in your shopping cart.

Human MIP 5 Protein

SKU: orb427131

Description

Recombinant of human MIP 5 protein

Images & Validation

Application Notes
Chemokines

Key Properties

SourceEscherichia Coli
Biological ActivityDetermined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
Protein SequenceQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
PurityGreater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesMIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.

Similar Products

  • CCR5 Antibody [orb749468]

    FACS,  IF,  IHC-P

    Human

    Mouse

    Monoclonal

    Unconjugated

    100 μg, 20 μg
  • CCR5 Antibody [orb2638311]

    FACS,  IF,  IHC-P

    Human

    Mouse

    Monoclonal

    Unconjugated

    100 μg
  • Human Macrophage Inflammatory Protein 5 (MIP5) ELISA Kit [orb778438]

    Human

    15.63-1000 pg/mL

    6.1 pg/mL

    96 T, 48 T
  • Human Macrophage Inflammatory Protein 5 (MIP-5) ELISA Kit [orb1807346]

    Human

    0.16-10ng/mL

    0.10 ng/mL

    48 T, 96 T
  • Human CCL15 protein (Active) [orb359042]

    > 98% as determined by SDS-PAGE and HPLC.

    7.4 kDa

    E.Coli

    5 μg, 100 μg, 500 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human MIP 5 Protein (orb427131)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 250.00
25 μg
$ 350.00
1 mg
$ 3,620.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry