Human MIG Protein

• Catalog Number: orb427110
• Category: Proteins
• Description: Recombinant of human MIG protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.
• Purity: Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Protein Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
• Application notes: Chemokines
• Source: Escherichia Coli
• Biological Activity: Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
• Solubility (25°C): It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Storage: Stability: Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Alternative names: Small inducible cytokine B9, CXCL9, Gamma INF-indu
• Note: For research use only
• Expiration Date: 6 months from date of receipt.