You have no items in your shopping cart.
Human CXCL9 protein (Active)
SKU: orb359055
Featured
Active
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 100 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 11.7 kDa |
| Expression Region | 23-125aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
| Disclaimer | For research use only |
Alternative Names
−Gamma-interferon-induced monokine, HuMIG, MIG, Small-inducible cytokine B9,
Similar Products
−RecombinantI‑TAC/CXCL11,Human(HEK293-expressed) [orb1494634]
> 98% as analyzed by SDS-PAGE.
8.3 kDa, observed by reducing SDS-PAGE.
HEK 293
50 μg, 10 μgRecombinant Human C-X-C motif chemokine 9 protein(CXCL9) (Active) [orb1650752]
1 mg, 500 μg, 5 μg, 20 μg, 100 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CXCL9 protein (Active) (orb359055)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review