You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604246 |
---|---|
Category | Proteins |
Description | Recombinant Human Macrophage migration inhibitory factor(MIF) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.1 kDa |
UniProt ID | P14174 |
Protein Sequence | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 2-115aa. Protein Length: Full Length of Mature Protein |
Expression Region | 2-115aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Glycosylation-inhibiting factor (GIF) (L-dopachrom Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
41.3 kDa | |
Mammalian cell |
Unconjugated | |
95% | |
10.8 kDa | |
Human S100A8, Tag Free (orb257818) is expressed from E.coli cells. It contains AA Met 1 - Glu 93 (Accession # AAH05928). |
Unconjugated | |
95% | |
19.3 kDa | |
Human CD74, His Tag (orb257272) is expressed from human 293 cells (HEK293). It contains AA Gln 73 - Met 232 (Accession # NP_004346.1). |
Greater than 90% as determined by SDS-PAGE. | |
16.3 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
14.4 kDa | |
Yeast |
Filter by Rating