You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Human MIF protein
Catalog Number: orb605235
| Catalog Number | orb605235 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Macrophage migration inhibitory factor(MIF) |
| Tag | C-terminal hFc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 41.3 kDa |
| UniProt ID | P14174 |
| Protein Sequence | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml. |
| Expression Region | 2-115aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Alternative names | (MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopa Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml.
- Item 1 of 3
Human S100A9 Protein, hFc Tag [orb1743265]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.4 kDa after removal of the signal peptide. The apparent molecular mass of hFc-S100A9 is approximately 35-55 kDa due to glycosylation.
E.coli
50 μg, 10 μg, 100 μg - Item 1 of 2
Human MIF Protein, hFc Tag [orb1173924]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.5 kDa after removal of the signal peptide. The apparent molecular mass of MIF-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Human MIF protein [orb604247]
Greater than 90% as determined by SDS-PAGE.
16.3 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Recombinant human AMH protein, C-His (HEK293) [orb1516591]
> 90% as determined by SDS-PAGE
55-65 kDa
100 μg, 500 μg
