Human MIF protein

• Catalog Number: orb605235
• Category: Proteins
• Description: Recombinant Human Macrophage migration inhibitory factor(MIF)
• Tag: C-terminal hFc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 41.3 kDa
• UniProt ID: P14174
• Protein Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
• Protein Length: Full Length of Mature Protein
• Source: Mammalian cell
• Expression System: 2-115aa
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml.
• Expression Region: 2-115aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Alternative names: (MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopa
• Note: For research use only
• Application notes: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.