You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human MICA protein
Catalog Number: orb594909
| Catalog Number | orb594909 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human MHC class I polypeptide-related sequence A(MICA),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 59.9 kDa |
| UniProt ID | AAH16929.1 |
| Protein Sequence | EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml. |
| Expression Region | 24-308aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | MHC Class I Polypeptide-Related Sequence A; MIC-A; Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
Human MICAa3 Protein, His Tag [orb1826752]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 12.5 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human MICAa3 Protein, mFc Tag [orb1826753]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 37.9 kDa after removal of the signal peptide. The apparent molecular mass of MICAa3(203-306)-mFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
Recombinant human MICA protein, C-His-Avi (HEK293) [orb1516387]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 55-70 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Recombinant human MICA protein, C-His-Avi (HEK293), Biotin conjugated [orb2328746]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 55-70 kDa based on Tris-Bis PAGE result.
50 μg
