Human MICA protein

SKU: orb594909

Description

This Human MICA protein spans the amino acid sequence from region 24-308aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.
• Tag: C-terminal Fc-tagged
• Molecular Weight: 59.9 kDa
• Expression Region: 24-308aa
• Protein Length: Partial
• Protein Sequence: EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

AAH16929.1