You have no items in your shopping cart.
Cart summary
Human MICA Protein
Catalog Number: orb427093
| Catalog Number | orb427093 |
|---|---|
| Category | Proteins |
| Description | Recombinant of human MICA protein |
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Protein Sequence | EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH |
| Application notes | Recombinant & Natural Proteins |
| Source | Escherichia Coli |
| Biological Activity | Measured by its ability to bind MICA antibody in ELISA. |
| Solubility (25°C) | It is recommended to reconstitute the lyophilized MICA in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | Stability: Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MICA should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
| Alternative names | MHC class I polypeptide-related sequence A, MIC-A, Read more... |
| Note | For research use only |
- Item 1 of 1
- Item 1 of 1
Human MICAa3 Protein, His Tag [orb1826752]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 12.5 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human MICAa3 Protein, mFc Tag [orb1826753]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 37.9 kDa after removal of the signal peptide. The apparent molecular mass of MICAa3(203-306)-mFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human MICA protein [orb594909]
Greater than 95% as determined by SDS-PAGE.
59.9 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg - Item 1 of 2
Recombinant human MICA protein, C-His-Avi (HEK293) [orb1516387]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 55-70 kDa based on Tris-Bis PAGE result.
50 μg
