Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 5-10 working days
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00Product Overview
Product Name | Human MICA protein |
---|---|
Catalog Number | orb427093 |
Reactivity | Human |
Conjugation | Unconjugated |
Target | MICA |
Product Properties
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. Lyophilized from a concentrated (1mg/ml) solution containing no additives. |
---|---|
Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Note | For research use only. |
Protein Sequence | EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH. |
Purity | >95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Source | Escherichia Coli. |
Activity | Measured by its ability to bind MICA antibody in ELISA. |
Product Description
Recombinant of human MICA protein
Solubility (25°C)
Solubility (25°C) | It is recommended to reconstitute the lyophilized MICA in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
---|
Reviews
Write Your Own Review