You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246555 |
---|---|
Category | Proteins |
Description | Recombinant human Lymphocyte antigen 6E |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 24.5 kDa |
UniProt ID | Q16553 |
Protein Sequence | LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 21-101aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose |
Alternative names | LY6E Read more... |
Note | For research use only |
Application notes | This is His-SUMO-tag protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, FC, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Greater than 95% as determined by SDS-PAGE. | |
34.5 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
15.4 kDa | |
E.coli |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. | |
Mammalian |