You have no items in your shopping cart.
Cart summary
Human KLRK1 protein
Catalog Number: orb605229
| Catalog Number | orb605229 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human NKG2-D type II integral membrane protein(KLRK1),partial |
| Tag | C-terminal hFc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| MW | 43.6 kDa |
| UniProt ID | P26718 |
| Protein Sequence | FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 78-216aa. Protein Length: Partial |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml. |
| Expression Region | 78-216aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Alternative names | Killer cell lectin-like receptor subfamily K membe Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human MICA Protein [orb257689]
Unconjugated
95%
33.8 kDa
Human MICA, His Tag (orb257689) is expressed from human 293 cells (HEK293). It contains AA Glu 24 - Gln 308 (Accession # AAH16929.1).
1 mg, 100 μg Human KLRK1 protein [orb706878]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman KLRK1 protein [orb706879]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman NKG2D Protein, mFc Tag [orb689424]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.8 kDa after removal of the signal peptide.The apparent molecular mass of mFc-NKG2D is approximately 50-65 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars